PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1333010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-PHD
Protein Properties Length: 716aa    MW: 80575.5 Da    PI: 8.531
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1333010.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.5e-10498542953
                      HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      ++ le L ++F++n  p ++ +e L+k+lg++ ++V+ WF+N R+
  Lj6g3v1333010.1 498 HDALEKLRQVFAENELPPRSVKEGLSKELGIDAAKVSKWFKNARY 542
                      6889***************************************96 PP

2PHD40.85.2e-14234289151
                      SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      +C+ C+   +  +++++lCd +C+++fH+ Cl+++l++e++p g   w+C+ C++k
  Lj6g3v1333010.1 234 FCANCKLreAFPDNDIILCDgTCNRAFHQRCLNPPLDTENIPPGdqGWFCNFCECK 289
                      699999954555********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.1E-14225291IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.5E-12231290IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.54232289IPR019787Zinc finger, PHD-finger
SMARTSM002491.9E-9234287IPR001965Zinc finger, PHD-type
PfamPF006285.2E-11234289IPR019787Zinc finger, PHD-finger
CDDcd155046.44E-29234286No hitNo description
PROSITE patternPS013590235286IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.605.3E-10478541IPR009057Homeodomain-like
SuperFamilySSF466894.11E-9485542IPR009057Homeodomain-like
PROSITE profilePS5007110.884487547IPR001356Homeobox domain
SMARTSM003891.6E-4489551IPR001356Homeobox domain
CDDcd000861.93E-6495542No hitNo description
PfamPF000461.4E-7498542IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MQGTEKLNGT GSTKSSNSEE HAESKVDSLR YRTNITKCRG KKQKLKSKSH KLSGCLSASG  60
RTVTNSSIKR QVKDSSNKKI IRQSLHKTDG KSSRMLSSTM IQGGKSSLGS RKEGKDVDGE  120
VMVQKVKRKR KKKRRQDDVD LDDASRLLRR TRYLLIKMKL EQNLIDAYSG EGWKGQSREK  180
IRPEKELQRA KKQILNCKLS IRDAIRQLDS LSSLGSIEDS VIDPDGSVYH EHIFCANCKL  240
REAFPDNDII LCDGTCNRAF HQRCLNPPLD TENIPPGDQG WFCNFCECKI EILEATNAHL  300
GTQISLDSTW QDVFKEEAAI PDGDNALLNP EEEWPSDDPE DDDYYPERKE DNHSIKAEGT  360
DDNASNDLSS SSSLGSLNGE CSPVDEGTGL EYYSVNCCID SDDSGEIACG RRQRKSVDYK  420
KLYDEMFGKD APPCELVSED EDWGTGKRKR REKESDAVNT LMTMHESENK NPNNENSDGI  480
REGSSGKPIR RSCFRIPHDA LEKLRQVFAE NELPPRSVKE GLSKELGIDA AKVSKWFKNA  540
RYFALKARKY QAGGEQLQSF TSKTPKDSRS QNVDKDELLK SMASKITVTQ YQKNGKNVTG  600
REKIKSCSSP LKKRRLQIPP PLRENGNKGS MEVNDDVSLK KLLKEKKTRV NFISEGDSQA  660
AELEFERISK LKAKLDSMKQ KLTEVQNLRA SGSDKLCSNE PSVIYVPIAE LREKVE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134KRKRKKKRR
2127131RKRKK
3128134KRKKKRR
4128135KRKKKRRQ
5130134KKKRR
6447452RKRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0045170.0AP004517.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT14B06, TM0045, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004487993.10.0PREDICTED: pathogenesis-related homeodomain protein
SwissprotP487851e-150PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLK7MBU20.0K7MBU2_SOYBN; Uncharacterized protein
STRINGGLYMA15G17956.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-94pathogenesis related homeodomain protein A